2r1j/1/1:L/1:R

Sequences
>2r1j-a1-m1-cL (length=66) [Search sequence]
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPD
YLLKGD
>2r1j-a1-m1-cR (length=66) [Search sequence]
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPD
YLLKGD
Structure information
PDB ID 2r1j (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the P22 c2 Repressor protein in complex with the synthetic operator 9T
Assembly ID 1
Resolution 1.53Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
PubMed citation 18237194
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID L R
UniProt accession P69202 P69202
Species 10754 (Lederbergvirus P22) 10754 (Lederbergvirus P22)
Function annotation BioLiP:2r1jL BioLiP:2r1jR
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2r1j-a1-m1-cL_2r1j-a1-m1-cR.pdb.gz
Full biological assembly
Download: 2r1j-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3jxb/1/1:D/1:C 3jxc/1/1:L/1:R 3jxd/1/1:L/1:R

[Back to Home]