2r41/3/3:B/3:D

Sequences
>2r41-a3-m3-cB (length=101) [Search sequence]
FERFDSDRSRYASLGVVSSLPSGLIDSIWLIIDLNLKGVIPLNDLLHFDLLNNNGKVTVH
FSQENSSVEAIDLPFSYSTAYPSRIFAFDDGHRETILLPAE
>2r41-a3-m3-cD (length=102) [Search sequence]
FERFDSDRSRYASLGVVSSLPSGLIDSIWLIIDLNLKGVIPLNDLLHFDLLNNNGKVTVH
FSQENSSVEAIDLPFSYSTAYPSRIFAFDDGHRETILLPAEL
Structure information
PDB ID 2r41 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the protein of unknown function from Enterococcus faecalis
Assembly ID 3
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID B D
UniProt accession Q837L7 Q837L7
Species 226185 (Enterococcus faecalis V583) 226185 (Enterococcus faecalis V583)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2r41-a3-m3-cB_2r41-a3-m3-cD.pdb.gz
Full biological assembly
Download: 2r41-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2r41/1/1:A/1:C 2r41/1/1:B/1:D 2r41/1/2:A/2:C 2r41/1/2:B/2:D 2r41/2/1:A/1:C 2r41/2/1:B/1:D 2r41/3/1:A/1:C
Other dimers with similar sequences but different poses
  • 2r41/2/1:A/1:B 2r41/1/1:A/1:B 2r41/1/2:A/2:B
  • 2r41/2/1:A/1:D 2r41/1/1:A/1:D 2r41/1/1:B/1:C 2r41/1/2:A/2:D 2r41/1/2:B/2:C 2r41/2/1:B/1:C
  • 2r41/1/1:A/2:D 2r41/1/1:B/2:C 2r41/1/2:A/1:D 2r41/1/2:B/1:C
  • 2r41/1/1:D/2:D 2r41/1/1:C/2:C
  • 2r41/3/3:D/1:C 2r41/3/1:A/3:B
  • [Back to Home]