2r78/2/1:D/1:C

Sequences
>2r78-a2-m1-cD (length=114) [Search sequence]
GTENLYFQSNAYRALFEHAIDGIFIDAEGHYLDVNPAICSAIGYTRDEFLALDWGVLSRG
VDSGWAAASLARIVGGEPLREERTVWTRNGDQLTVELSAHLLPDGKILGIARDV
>2r78-a2-m1-cC (length=115) [Search sequence]
LGTENLYFQSNAYRALFEHAIDGIFIDAEGHYLDVNPAICSAIGYTRDEFLALDWGVLSR
GVDSGWAAASLARIVGGEPLREERTVWTRNGDQLTVELSAHLLPDGKILGIARDV
Structure information
PDB ID 2r78 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a domain of the sensory box sensor histidine kinase/response regulator from Geobacter sulfurreducens
Assembly ID 2
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q74DN1 Q74DN1
Species 243231 (Geobacter sulfurreducens PCA) 243231 (Geobacter sulfurreducens PCA)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2r78-a2-m1-cD_2r78-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2r78-assembly2.cif.gz
Similar dimers

[Back to Home]