2raq/1/2:F/2:G

Sequences
>2raq-a1-m2-cF (length=91) [Search sequence]
AKGLIRIVLDILKPHEPIIPEYAKYLSELRGVEGVNITLEIDKETENIKVTIQGNDLDFD
EITRAIESYGGSIHSVDEVVAGRTVEEVTTP
>2raq-a1-m2-cG (length=91) [Search sequence]
AKGLIRIVLDILKPHEPIIPEYAKYLSELRGVEGVNITLEIDKETENIKVTIQGNDLDFD
EITRAIESYGGSIHSVDEVVAGRTVEEVTTP
Structure information
PDB ID 2raq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the MTH889 protein from Methanothermobacter thermautotrophicus. Northeast Structural Genomics Consortium target TT205
Assembly ID 1
Resolution 3.11Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID F G
UniProt accession O26975 O26975
Species 187420 (Methanothermobacter thermautotrophicus str. Delta H) 187420 (Methanothermobacter thermautotrophicus str. Delta H)
Function annotation BioLiP:2raqF
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2raq-a1-m2-cF_2raq-a1-m2-cG.pdb.gz
Full biological assembly
Download: 2raq-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2raq/1/1:A/1:B 2raq/1/1:A/1:G 2raq/1/1:C/1:B 2raq/1/1:C/1:D 2raq/1/1:D/1:E 2raq/1/1:E/1:F 2raq/1/1:F/1:G 2raq/1/2:A/2:B 2raq/1/2:A/2:G 2raq/1/2:C/2:B 2raq/1/2:C/2:D 2raq/1/2:D/2:E 2raq/1/2:E/2:F
Other dimers with similar sequences but different poses
  • 2raq/1/1:E/2:G 2raq/1/1:A/2:D 2raq/1/1:C/2:B 2raq/1/1:D/2:A 2raq/1/1:F/2:F 2raq/1/1:G/2:E 2raq/1/2:C/1:B
  • [Back to Home]