2rb6/3/2:B/1:A

Sequences
>2rb6-a3-m2-cB (length=52) [Search sequence]
SSQYISTKDGKITSDSKPKLDKTTGYLYYDEDGREVIKQEDVTQIIERLEHH
>2rb6-a3-m1-cA (length=53) [Search sequence]
SSQYISTKDGKITSDSKPKLDKTTGYLYYDEDGREVIKQEDVTQIIERLEHHH
Structure information
PDB ID 2rb6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-Ray structure of the protein Q8EI81. Northeast Structural Genomics Consortium target SoR78A
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q8EI81 Q8EI81
Species 211586 (Shewanella oneidensis MR-1) 211586 (Shewanella oneidensis MR-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2rb6-a3-m2-cB_2rb6-a3-m1-cA.pdb.gz
Full biological assembly
Download: 2rb6-assembly3.cif.gz

[Back to Home]