2ret/1/1:C/1:G

Sequences

>2ret-a1-m1-cC (length=75) [Search sequence]

TVGYLEQKFAAVADNQAVLNPKLKASNGEEELAGQTWYWKVAPVATQPLLKAFDVSVAAT TQASPIITVRSYVAS

>2ret-a1-m1-cG (length=76) [Search sequence]

TVGYLEQKFAAVADNQAVLNPKNLKASNGEEELAGQTWYWKVAPVATTQPLLKAFDVSVA ATTQASPIITVRSYVA

Structure information

PDB ID	2ret (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of a binary complex of two pseudopilins: EpsI and EpsJ from the Type 2 Secretion System of Vibrio vulnificus
Assembly ID	1
Resolution	2.21Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	0.987

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	G
UniProt accession	Q7MPZ1	Q7MPZ1
Species	672 (Vibrio vulnificus)	672 (Vibrio vulnificus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2ret-a1-m1-cC_2ret-a1-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2ret-assembly1.cif.gz

Similar dimers