2rhk/2/2:D/1:C

Sequences

>2rhk-a2-m2-cD (length=60) [Search sequence]

SHMSGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMSECYFYSKFGECSNKECPFLHIDP

>2rhk-a2-m1-cC (length=63) [Search sequence]

HHSHMSGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMSECYFYSKFGECSNKECPFLHI DPE

Structure information

PDB ID	2rhk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of influenza A NS1A protein in complex with F2F3 fragment of human cellular factor CPSF30, Northeast Structural Genomics Targets OR8C and HR6309A
Assembly ID	2
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0
PubMed citation	18725644

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	D	C
UniProt accession	O95639	O95639
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2rhkD	BioLiP:2rhkC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2rhk-a2-m2-cD_2rhk-a2-m1-cC.pdb.gz

Full biological assembly Download: 2rhk-assembly2.cif.gz