2ria/1/1:B/1:C

Sequences
>2ria-a1-m1-cB (length=146) [Search sequence]
QVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLA
SPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSE
DCVEIFTNGKWNDRACGEKRLVVCEF
>2ria-a1-m1-cC (length=146) [Search sequence]
QVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLA
SPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSE
DCVEIFTNGKWNDRACGEKRLVVCEF
Structure information
PDB ID 2ria (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with D-glycero-D-manno-heptose
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
PubMed citation 18092821
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P35247 P35247
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2riaB BioLiP:2riaC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ria-a1-m1-cB_2ria-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2ria-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1b08/1/1:B/1:A 1b08/1/1:C/1:A 1b08/1/1:C/1:B 1pw9/1/1:A/1:B 1pw9/1/1:C/1:A 1pw9/1/1:C/1:B 1pwb/1/1:A/1:B 1pwb/1/1:C/1:A 1pwb/1/1:C/1:B 2ggu/1/1:A/1:B 2ggu/1/1:A/1:C 2ggu/1/1:B/1:C 2ggx/1/1:A/1:B 2ggx/1/1:A/1:C 2ggx/1/1:B/1:C 2orj/1/1:A/1:B 2orj/1/1:A/1:C 2orj/1/1:B/1:C 2ork/1/1:A/1:B 2ork/1/1:C/1:A 2ork/1/1:C/1:B 2os9/1/1:A/1:B 2os9/1/1:C/1:A 2os9/1/1:C/1:B 2ria/1/1:A/1:B 2ria/1/1:A/1:C 2rib/1/1:A/1:B 2rib/1/1:A/1:C 2rib/1/1:C/1:B 2ric/1/1:A/1:C 2ric/1/1:B/1:A 2ric/1/1:B/1:C 2rid/1/1:A/1:B 2rid/1/1:A/1:C 2rid/1/1:C/1:B 2rie/1/1:A/1:B 2rie/1/1:A/1:C 2rie/1/1:C/1:B 3dbz/1/1:A/1:B 3dbz/1/1:C/1:A 3dbz/1/1:C/1:B 3g81/1/1:A/1:B 3g81/1/1:C/1:A 3g81/1/1:C/1:B 3g83/1/1:A/1:B 3g83/1/1:C/1:A 3g83/1/1:C/1:B 3g84/1/1:A/1:B 3g84/1/1:A/1:C 3g84/1/1:B/1:C 3ikn/1/1:A/1:B 3ikn/1/1:A/1:C 3ikn/1/1:B/1:C 3ikp/1/1:A/1:B 3ikp/1/1:C/1:A 3ikp/1/1:C/1:B 3ikq/1/1:A/1:B 3ikq/1/1:C/1:A 3ikq/1/1:C/1:B 3ikr/1/1:A/1:C 3ikr/1/1:B/1:A 3ikr/1/1:B/1:C 4e52/1/1:A/1:B 4e52/1/1:A/1:C 4e52/1/1:B/1:C 4m17/1/1:A/1:B 4m17/1/1:A/1:C 4m17/1/1:B/1:C 4m17/2/1:D/1:E 4m17/2/1:D/1:F 4m17/2/1:E/1:F 4m17/3/1:G/1:H 4m17/3/1:G/1:I 4m17/3/1:I/1:H 4m17/4/1:K/1:J 4m17/4/1:L/1:J 4m17/4/1:L/1:K 4m18/1/1:A/1:B 4m18/1/1:A/1:C 4m18/1/1:B/1:C 4m18/2/1:D/1:E 4m18/2/1:D/1:F 4m18/2/1:E/1:F 4m18/3/1:G/1:H 4m18/3/1:I/1:G 4m18/3/1:I/1:H 4m18/4/1:J/1:K 4m18/4/1:J/1:L 4m18/4/1:K/1:L 5oxr/1/1:A/1:B 5oxr/1/1:A/1:C 5oxr/1/1:C/1:B 5oxs/1/1:A/1:B 5oxs/1/1:A/1:C 5oxs/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 1m7l/1/1:B/1:C 1m7l/1/1:A/1:B 1m7l/1/1:A/1:C
  • [Back to Home]