2v08/1/1:A/3:B

Sequences
>2v08-a1-m1-cA (length=84) [Search sequence]
DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQVTNGKAGMPAF
KGRLTDDQIAAVAAYVLDQAEKGW
>2v08-a1-m3-cB (length=84) [Search sequence]
DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQVTNGKAGMPAF
KGRLTDDQIAAVAAYVLDQAEKGW
Structure information
PDB ID 2v08 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of wild-type Phormidium laminosum cytochrome c6
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 17625855
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A B
UniProt accession F2Z292 F2Z292
Species 32059 (Phormidium laminosum) 32059 (Phormidium laminosum)
Function annotation BioLiP:2v08A BioLiP:2v08B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2v08-a1-m1-cA_2v08-a1-m3-cB.pdb.gz
Full biological assembly
Download: 2v08-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2v08/1/1:B/2:A 2v08/1/2:B/3:A
Other dimers with similar sequences but different poses
  • 2v08/1/3:A/3:B 2v08/1/1:A/1:B 2v08/1/2:A/2:B
  • 2v08/1/2:B/3:B 2v08/1/1:A/2:A 2v08/1/1:A/3:A 2v08/1/1:B/2:B 2v08/1/1:B/3:B 2v08/1/2:A/3:A
  • [Back to Home]