2v2h/1/1:B/1:C

Sequences

>2v2h-a1-m1-cB (length=241) [Search sequence]

SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVASTFVHLAMTKERLSHPKFVI
AAQNAGNADALASLKDFGVNWIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE
TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVLTPQQAQEAHAL
IRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPEFVDIIKAT
Q

>2v2h-a1-m1-cC (length=241) [Search sequence]

Structure information

PDB ID	2v2h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The A178L mutation in the C-terminal hinge of the flexible loop-6 of triosephosphate isomerase (TIM) induces a more closed conformation of this hinge region in dimeric and monomeric TIM
Assembly ID	1
Resolution	1.18Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0
PubMed citation	18219118

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P04789	P04789
Species	5702 (Trypanosoma brucei brucei)	5702 (Trypanosoma brucei brucei)
Function annotation	BioLiP:2v2hB	BioLiP:2v2hC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2v2h-a1-m1-cB_2v2h-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2v2h-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2v2h/1/1:A/1:B 2v2h/1/1:A/1:C
Other dimers with similar sequences but different poses	2v2d/1/2:A/3:A 1ml1/1/1:A/1:C 1ml1/3/1:I/1:K 2v2d/1/1:A/2:A 2v2d/1/1:A/3:A 2vei/1/1:A/1:B 2vei/1/1:A/1:C 2vei/1/1:B/1:C 4pcf/4/1:A/1:B 4pcf/4/1:A/1:C 4pcf/4/1:B/1:C 2y70/2/1:A/1:D 2wsq/1/1:B/1:C 2wsq/2/1:A/1:D 2y6z/1/1:A/2:A 2y70/1/1:B/1:C