2v4h/1/2:B/2:A

Sequences

>2v4h-a1-m2-cB (length=91) [Search sequence]

HMASMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ AERHAREKLVEKKEYLQEQLEQLQREFNKLK

>2v4h-a1-m2-cA (length=98) [Search sequence]

GLVPRGSHMASMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQAD IYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLK

Structure information

PDB ID	2v4h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NEMO CC2-LZ domain - 1D5 DARPin complex
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	124
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	B	A
UniProt accession	O88522	O88522
Species	10090 (Mus musculus)	10090 (Mus musculus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2v4h-a1-m2-cB_2v4h-a1-m2-cA.pdb.gz

Full biological assembly Download: 2v4h-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2v4h/1/1:B/1:A 2zvn/1/1:B/1:D 2zvn/2/1:F/1:H 2zvo/1/1:B/1:D 3f89/1/1:B/1:A 4owf/1/1:A/1:B 6xx0/1/1:A/1:B 6yek/1/1:B/1:A 7tv4/1/1:D/1:B
Other dimers with similar sequences but different poses	2v4h/1/2:B/1:A 2v4h/1/1:B/2:A 4bwn/1/1:A/1:B 3fx0/1/1:A/1:B