2v6t/1/1:B/2:B

Sequences

>2v6t-a1-m1-cB (length=100) [Search sequence]

LARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHP NWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE

>2v6t-a1-m2-cB (length=100) [Search sequence]

LARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHP NWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE

Structure information

PDB ID	2v6t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from Toxoplasma gondii with 7,8-dihydrobiopterin
Assembly ID	1
Resolution	3.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0
PubMed citation	18215430

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	Q2Q449	Q2Q449
Species	383379 (Toxoplasma gondii RH)	383379 (Toxoplasma gondii RH)
Function annotation	BioLiP:2v6tB	BioLiP:2v6tB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2v6t-a1-m1-cB_2v6t-a1-m2-cB.pdb.gz

Full biological assembly Download: 2v6t-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2v6s/1/1:A/2:A 2v6s/1/1:B/2:B 2v6t/1/1:A/2:A 2v6u/1/1:A/2:A 2v6u/1/1:B/2:B
Other dimers with similar sequences but different poses	2v6u/1/2:B/2:A 2v6s/1/1:B/1:A 2v6s/1/2:B/2:A 2v6t/1/1:A/1:B 2v6t/1/2:A/2:B 2v6u/1/1:B/1:A 2v6u/1/2:B/1:A 2v6s/1/1:B/2:A 2v6s/1/2:B/1:A 2v6t/1/1:A/2:B 2v6t/1/2:A/1:B 2v6u/1/1:B/2:A