2v6u/1/2:B/1:A

Sequences
>2v6u-a1-m2-cB (length=99) [Search sequence]
ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPN
WYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
>2v6u-a1-m1-cA (length=103) [Search sequence]
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVD
HHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE
Structure information
PDB ID 2v6u (database links: RCSB PDB PDBe PDBj PDBsum)
Title High resolution crystal structure of pterin-4a-carbinolamine dehydratase from Toxoplasma gondii
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q2Q449 Q2Q449
Species 383379 (Toxoplasma gondii RH) 383379 (Toxoplasma gondii RH)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2v6u-a1-m2-cB_2v6u-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2v6u-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2v6s/1/1:B/2:A 2v6s/1/2:B/1:A 2v6t/1/1:A/2:B 2v6t/1/2:A/1:B 2v6u/1/1:B/2:A
Other dimers with similar sequences but different poses
  • 2v6t/1/1:B/2:B 2v6s/1/1:A/2:A 2v6s/1/1:B/2:B 2v6t/1/1:A/2:A 2v6u/1/1:A/2:A 2v6u/1/1:B/2:B
  • 2v6u/1/2:B/2:A 2v6s/1/1:B/1:A 2v6s/1/2:B/2:A 2v6t/1/1:A/1:B 2v6t/1/2:A/2:B 2v6u/1/1:B/1:A
  • [Back to Home]