2v6u/1/2:B/2:A

Sequences

>2v6u-a1-m2-cB (length=99) [Search sequence]

ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPN WYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE

>2v6u-a1-m2-cA (length=103) [Search sequence]

MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVD HHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNFE

Structure information

PDB ID	2v6u (database links: RCSB PDB PDBe PDBj PDBsum)
Title	High resolution crystal structure of pterin-4a-carbinolamine dehydratase from Toxoplasma gondii
Assembly ID	1
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	B	A
UniProt accession	Q2Q449	Q2Q449
Species	383379 (Toxoplasma gondii RH)	383379 (Toxoplasma gondii RH)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2v6u-a1-m2-cB_2v6u-a1-m2-cA.pdb.gz

Full biological assembly Download: 2v6u-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2v6s/1/1:B/1:A 2v6s/1/2:B/2:A 2v6t/1/1:A/1:B 2v6t/1/2:A/2:B 2v6u/1/1:B/1:A
Other dimers with similar sequences but different poses	2v6t/1/1:B/2:B 2v6s/1/1:A/2:A 2v6s/1/1:B/2:B 2v6t/1/1:A/2:A 2v6u/1/1:A/2:A 2v6u/1/1:B/2:B 2v6u/1/2:B/1:A 2v6s/1/1:B/2:A 2v6s/1/2:B/1:A 2v6t/1/1:A/2:B 2v6t/1/2:A/1:B 2v6u/1/1:B/2:A