2v79/1/1:A/2:B

Sequences

>2v79-a1-m1-cA (length=115) [Search sequence]

MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEG MSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQN

>2v79-a1-m2-cB (length=117) [Search sequence]

MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEG MSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQNQT

Structure information

PDB ID	2v79 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the N-terminal domain of DnaD from Bacillus Subtilis
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	P39787	P39787
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2v79-a1-m1-cA_2v79-a1-m2-cB.pdb.gz

Full biological assembly Download: 2v79-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2v79/1/2:A/1:B 8ojj/1/1:A/1:C 8ojj/1/1:B/1:D
Other dimers with similar sequences but different poses	2v79/1/2:A/2:B 2v79/1/1:A/1:B 8ojj/1/1:A/1:B 8ojj/1/1:C/1:D