2v79/1/2:A/2:B

Sequences
>2v79-a1-m2-cA (length=115) [Search sequence]
MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEG
MSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQN
>2v79-a1-m2-cB (length=117) [Search sequence]
MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEG
MSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQNQT
Structure information
PDB ID 2v79 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the N-terminal domain of DnaD from Bacillus Subtilis
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 101
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P39787 P39787
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2v79-a1-m2-cA_2v79-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2v79-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2v79/1/1:A/1:B 8ojj/1/1:A/1:B 8ojj/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2v79/1/1:A/2:B 2v79/1/2:A/1:B 8ojj/1/1:A/1:C 8ojj/1/1:B/1:D
  • [Back to Home]