2v90/2/1:D/1:B

Sequences

>2v90-a2-m1-cD (length=93) [Search sequence]

PRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGESVE GLGHEETVSRIQGQGSCVSLTVVDPEADRETSV

>2v90-a2-m1-cB (length=95) [Search sequence]

MKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGES VEGLGHEETVSRIQGQGSCVSLTVVDPEADRETSV

Structure information

PDB ID	2v90 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the 3rd PDZ domain of intestine- and kidney- enriched PDZ domain IKEPP (PDZD3)
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	Q86UT5	Q86UT5
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2v90-a2-m1-cD_2v90-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2v90-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2v90/2/1:D/1:F 2v90/1/1:C/1:E