2vs0/1/1:A/1:B

Sequences
>2vs0-a1-m1-cA (length=81) [Search sequence]
IKSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEK
FAQLLEEIKQQLNSTADAVQE
>2vs0-a1-m1-cB (length=83) [Search sequence]
IKSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEK
FAQLLEEIKQQLNSTADAVQEQD
Structure information
PDB ID 2vs0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural analysis of homodimeric staphylococcal aureus virulence factor EsxA
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 85
Sequence identity between the two chains 1.0
PubMed citation 18773907
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q99WU4 Q99WU4
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
Function annotation BioLiP:2vs0B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2vs0-a1-m1-cA_2vs0-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2vs0-assembly1.cif.gz
Similar dimers

[Back to Home]