2vxa/1/1:E/1:L

Sequences
>2vxa-a1-m1-cE (length=66) [Search sequence]
DHVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVK
VGFTLE
>2vxa-a1-m1-cL (length=66) [Search sequence]
DHVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVK
VGFTLE
Structure information
PDB ID 2vxa (database links: RCSB PDB PDBe PDBj PDBsum)
Title H. halophila dodecin in complex with riboflavin
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation 19224924
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E L
UniProt accession A1WUH0 A1WUH0
Species 1053 (Halorhodospira halophila) 1053 (Halorhodospira halophila)
Function annotation BioLiP:2vxaE BioLiP:2vxaL
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2vxa-a1-m1-cE_2vxa-a1-m1-cL.pdb.gz
Full biological assembly
Download: 2vxa-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2vxa/1/1:A/1:E 2vxa/1/1:A/1:L 2vxa/1/1:B/1:H 2vxa/1/1:B/1:K 2vxa/1/1:C/1:F 2vxa/1/1:C/1:G 2vxa/1/1:D/1:I 2vxa/1/1:D/1:J 2vxa/1/1:F/1:G 2vxa/1/1:H/1:K 2vxa/1/1:I/1:J
Other dimers with similar sequences but different poses
  • 2vxa/1/1:K/1:L 2vxa/1/1:A/1:B 2vxa/1/1:A/1:C 2vxa/1/1:B/1:C 2vxa/1/1:D/1:E 2vxa/1/1:D/1:F 2vxa/1/1:E/1:F 2vxa/1/1:G/1:H 2vxa/1/1:G/1:I 2vxa/1/1:H/1:I 2vxa/1/1:J/1:K 2vxa/1/1:J/1:L
  • [Back to Home]