2vxa/1/1:E/1:L

Sequences

>2vxa-a1-m1-cE (length=66) [Search sequence]

DHVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVK VGFTLE

>2vxa-a1-m1-cL (length=66) [Search sequence]

DHVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVK VGFTLE

Structure information

PDB ID	2vxa (database links: RCSB PDB PDBe PDBj PDBsum)
Title	H. halophila dodecin in complex with riboflavin
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0
PubMed citation	19224924

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	L
UniProt accession	A1WUH0	A1WUH0
Species	1053 (Halorhodospira halophila)	1053 (Halorhodospira halophila)
Function annotation	BioLiP:2vxaE	BioLiP:2vxaL

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2vxa-a1-m1-cE_2vxa-a1-m1-cL.pdb.gz

Full biological assembly Download: 2vxa-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2vxa/1/1:A/1:E 2vxa/1/1:A/1:L 2vxa/1/1:B/1:H 2vxa/1/1:B/1:K 2vxa/1/1:C/1:F 2vxa/1/1:C/1:G 2vxa/1/1:D/1:I 2vxa/1/1:D/1:J 2vxa/1/1:F/1:G 2vxa/1/1:H/1:K 2vxa/1/1:I/1:J
Other dimers with similar sequences but different poses	2vxa/1/1:K/1:L 2vxa/1/1:A/1:B 2vxa/1/1:A/1:C 2vxa/1/1:B/1:C 2vxa/1/1:D/1:E 2vxa/1/1:D/1:F 2vxa/1/1:E/1:F 2vxa/1/1:G/1:H 2vxa/1/1:G/1:I 2vxa/1/1:H/1:I 2vxa/1/1:J/1:K 2vxa/1/1:J/1:L