2w0c/1/54:P/9:P |
| >2w0c-a1-m54-cP (length=65) [Search sequence] |
MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGA AVVVE |
| >2w0c-a1-m9-cP (length=65) [Search sequence] |
MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGA AVVVE |
|
| PDB ID |
2w0c (database links:
RCSB PDB
PDBe
PDBj
PDBsum) |
| Title |
X-ray structure of the entire lipid-containing bacteriophage PM2 |
| Assembly ID |
1 |
| Resolution |
7Å |
| Method of structure determination |
X-RAY DIFFRACTION |
| Number of inter-chain contacts |
13 |
| Sequence identity between the two chains |
1.0 |
|
|
Chain 1 |
Chain 2 |
| Model ID |
54 |
9 |
| Chain ID |
P |
P |
| UniProt accession |
Q9XJR6 |
Q9XJR6 |
| Species |
10661 (Corticovirus PM2) |
10661 (Corticovirus PM2) |
|
Switch viewer: [NGL] [JSmol]
|
Dimer structure:
Chain 1 in red;
Chain 2 in blue.
|
Full biological assembly
|
|
| Other dimers with similar sequences and structures |
2w0c/1/10:P/23:P 2w0c/1/11:P/20:P 2w0c/1/11:P/38:P 2w0c/1/12:P/37:P 2w0c/1/12:P/47:P 2w0c/1/13:P/45:P 2w0c/1/13:P/46:P 2w0c/1/14:P/29:P 2w0c/1/14:P/44:P 2w0c/1/15:P/16:P 2w0c/1/15:P/28:P 2w0c/1/16:P/28:P 2w0c/1/17:P/27:P 2w0c/1/17:P/52:P 2w0c/1/18:P/51:P 2w0c/1/18:P/60:P 2w0c/1/19:P/39:P 2w0c/1/19:P/59:P 2w0c/1/1:P/10:P 2w0c/1/1:P/23:P 2w0c/1/20:P/38:P 2w0c/1/21:P/30:P 2w0c/1/21:P/43:P 2w0c/1/22:P/42:P 2w0c/1/24:P/54:P 2w0c/1/24:P/9:P 2w0c/1/25:P/26:P 2w0c/1/25:P/53:P 2w0c/1/26:P/53:P 2w0c/1/27:P/52:P 2w0c/1/29:P/44:P 2w0c/1/2:P/22:P 2w0c/1/2:P/42:P 2w0c/1/30:P/43:P 2w0c/1/31:P/40:P 2w0c/1/31:P/58:P 2w0c/1/32:P/57:P 2w0c/1/32:P/7:P 2w0c/1/33:P/5:P 2w0c/1/33:P/6:P 2w0c/1/34:P/49:P 2w0c/1/34:P/4:P 2w0c/1/35:P/36:P 2w0c/1/35:P/48:P 2w0c/1/36:P/48:P 2w0c/1/37:P/47:P 2w0c/1/39:P/59:P 2w0c/1/3:P/41:P 2w0c/1/3:P/50:P 2w0c/1/40:P/58:P 2w0c/1/41:P/50:P 2w0c/1/45:P/46:P 2w0c/1/4:P/49:P 2w0c/1/51:P/60:P 2w0c/1/55:P/56:P 2w0c/1/55:P/8:P 2w0c/1/56:P/8:P 2w0c/1/57:P/7:P 2w0c/1/5:P/6:P |
| Other dimers with similar sequences but different poses |
2w0c/1/9:Q/9:P 2w0c/1/10:Q/10:P 2w0c/1/11:Q/11:P 2w0c/1/12:Q/12:P 2w0c/1/13:Q/13:P 2w0c/1/14:Q/14:P 2w0c/1/15:Q/15:P 2w0c/1/16:Q/16:P 2w0c/1/17:Q/17:P 2w0c/1/18:Q/18:P 2w0c/1/19:Q/19:P 2w0c/1/1:Q/1:P 2w0c/1/20:Q/20:P 2w0c/1/21:Q/21:P 2w0c/1/22:Q/22:P 2w0c/1/23:Q/23:P 2w0c/1/24:Q/24:P 2w0c/1/25:Q/25:P 2w0c/1/26:Q/26:P 2w0c/1/27:Q/27:P 2w0c/1/28:Q/28:P 2w0c/1/29:Q/29:P 2w0c/1/2:Q/2:P 2w0c/1/30:Q/30:P 2w0c/1/31:Q/31:P 2w0c/1/32:Q/32:P 2w0c/1/33:Q/33:P 2w0c/1/34:Q/34:P 2w0c/1/35:Q/35:P 2w0c/1/36:Q/36:P 2w0c/1/37:Q/37:P 2w0c/1/38:Q/38:P 2w0c/1/39:Q/39:P 2w0c/1/3:Q/3:P 2w0c/1/40:Q/40:P 2w0c/1/41:Q/41:P 2w0c/1/42:Q/42:P 2w0c/1/43:Q/43:P 2w0c/1/44:Q/44:P 2w0c/1/45:Q/45:P 2w0c/1/46:Q/46:P 2w0c/1/47:Q/47:P 2w0c/1/48:Q/48:P 2w0c/1/49:Q/49:P 2w0c/1/4:Q/4:P 2w0c/1/50:Q/50:P 2w0c/1/51:Q/51:P 2w0c/1/52:Q/52:P 2w0c/1/53:Q/53:P 2w0c/1/54:Q/54:P 2w0c/1/55:Q/55:P 2w0c/1/56:Q/56:P 2w0c/1/57:Q/57:P 2w0c/1/58:Q/58:P 2w0c/1/59:Q/59:P 2w0c/1/5:Q/5:P 2w0c/1/60:Q/60:P 2w0c/1/6:Q/6:P 2w0c/1/7:Q/7:P 2w0c/1/8:Q/8:P |
|