2w8c/3/1:A/8:B

Sequences
>2w8c-a3-m1-cA (length=106) [Search sequence]
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKL
SHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
>2w8c-a3-m8-cB (length=106) [Search sequence]
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKL
SHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Structure information
PDB ID 2w8c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Plastocyanin variant with N-terminal Methionine - closed structure
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 19834935
Chain information
Chain 1 Chain 2
Model ID 1 8
Chain ID A B
UniProt accession Q51883 Q51883
Species 32059 (Phormidium laminosum) 32059 (Phormidium laminosum)
Function annotation BioLiP:2w8cA BioLiP:2w8cB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2w8c-a3-m1-cA_2w8c-a3-m8-cB.pdb.gz
Full biological assembly
Download: 2w8c-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2w88/1/1:A/2:B 2w88/1/1:B/2:A 2w88/1/1:C/2:C 2w8c/3/2:A/6:B 2w8c/3/3:A/7:B
Other dimers with similar sequences but different poses
  • 1baw/2/1:A/1:B 1baw/1/1:A/1:B 1baw/1/1:A/1:C 1baw/1/1:B/1:C 1baw/1/2:A/2:B 1baw/1/2:A/2:C 1baw/1/2:B/2:C 1baw/2/1:A/1:C 1baw/2/1:B/1:C 2q5b/4/1:A/1:B 2q5b/4/1:A/1:C 2q5b/4/1:B/1:C 2w88/1/1:A/1:B 2w88/1/1:A/1:C 2w88/1/1:B/1:C 2w88/1/2:A/2:B 2w88/1/2:A/2:C 2w88/1/2:B/2:C 2w8c/1/1:A/2:A 2w8c/1/1:A/3:A 2w8c/1/2:A/3:A 2w8c/2/1:B/4:B 2w8c/2/1:B/5:B 2w8c/2/4:B/5:B 2w8c/3/1:A/2:A 2w8c/3/1:A/3:A 2w8c/3/2:A/3:A 2w8c/3/6:B/7:B 2w8c/3/6:B/8:B 2w8c/3/7:B/8:B
  • 1baw/1/1:A/2:B 1baw/1/1:B/2:A 1baw/1/1:C/2:C
  • [Back to Home]