2wbt/1/1:B/1:A

Sequences
>2wbt-a1-m1-cB (length=111) [Search sequence]
KGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVC
PLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKHNICV
>2wbt-a1-m1-cA (length=125) [Search sequence]
DVDSGSKKYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLY
RLLASKAISQFVCPLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKH
NICVS
Structure information
PDB ID 2wbt (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of a Double C2H2 Zinc Finger Protein from a Hyperthermophilic Archaeal Virus in the Absence of DNA
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 153
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P20201 P20201
Species 244589 (Sulfolobus spindle-shaped virus 1) 244589 (Sulfolobus spindle-shaped virus 1)
Function annotation BioLiP:2wbtB BioLiP:2wbtA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2wbt-a1-m1-cB_2wbt-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2wbt-assembly1.cif.gz

[Back to Home]