2wcb/1/1:B/1:A

Sequences
>2wcb-a1-m1-cB (length=91) [Search sequence]
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHK
>2wcb-a1-m1-cA (length=92) [Search sequence]
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Structure information
PDB ID 2wcb (database links: RCSB PDB PDBe PDBj PDBsum)
Title S100A12 complex with zinc in the absence of calcium
Assembly ID 1
Resolution 1.73Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 95
Sequence identity between the two chains 1.0
PubMed citation 19501594
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P80511 P80511
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2wcbB BioLiP:2wcbA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2wcb-a1-m1-cB_2wcb-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2wcb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2wc8/1/1:A/1:B 2wc8/2/1:C/1:D
Other dimers with similar sequences but different poses
  • 1gqm/1/1:C/1:D 1e8a/1/1:A/1:B 1gqm/1/1:A/1:B 1gqm/1/1:E/1:F 1gqm/2/1:G/1:H 1gqm/2/1:I/1:J 1gqm/2/1:L/1:K 1odb/1/1:C/1:D 1odb/2/1:F/1:E 1odb/3/1:A/1:B 2m9g/1/1:A/1:B
  • 1gqm/2/1:G/1:I 1gqm/1/1:A/1:D 1gqm/1/1:A/1:E 1gqm/1/1:C/1:B 1gqm/1/1:C/1:F 1gqm/1/1:D/1:E 1gqm/1/1:F/1:B 1gqm/2/1:G/1:K 1gqm/2/1:I/1:K 1gqm/2/1:J/1:H 1gqm/2/1:L/1:H 1gqm/2/1:L/1:J
  • 2wcf/3/1:F/1:E 2wce/1/1:A/1:B 2wcf/1/1:A/1:B
    		•

    [Back to Home]