2wcf/3/1:F/1:E

Sequences

>2wcf-a3-m1-cF (length=88) [Search sequence]

STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKAVIDEIFQGLD ANQDEQVDFQEFISLVAIALKAAHYHTH

>2wcf-a3-m1-cE (length=90) [Search sequence]

STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG LDANQDEQVDFQEFISLVAIALKAAHYHTH

Structure information

PDB ID	2wcf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	calcium-free (apo) S100A12
Assembly ID	3
Resolution	2.78Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	P80511	P80511
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2wcf-a3-m1-cF_2wcf-a3-m1-cE.pdb.gz

Full biological assembly Download: 2wcf-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2wce/1/1:A/1:B 2wcf/1/1:A/1:B
Other dimers with similar sequences but different poses	1gqm/1/1:C/1:D 1e8a/1/1:A/1:B 1gqm/1/1:A/1:B 1gqm/1/1:E/1:F 1gqm/2/1:G/1:H 1gqm/2/1:I/1:J 1gqm/2/1:L/1:K 1odb/1/1:C/1:D 1odb/2/1:F/1:E 1odb/3/1:A/1:B 2m9g/1/1:A/1:B 1gqm/2/1:G/1:I 1gqm/1/1:A/1:D 1gqm/1/1:A/1:E 1gqm/1/1:C/1:B 1gqm/1/1:C/1:F 1gqm/1/1:D/1:E 1gqm/1/1:F/1:B 1gqm/2/1:G/1:K 1gqm/2/1:I/1:K 1gqm/2/1:J/1:H 1gqm/2/1:L/1:H 1gqm/2/1:L/1:J 2wcb/1/1:B/1:A 2wc8/1/1:A/1:B 2wc8/2/1:C/1:D