2wg5/2/1:K/1:L

Sequences

>2wg5-a2-m1-cK (length=87) [Search sequence]

MKQLEDKVEELLSKNYHLENEVARLRSPPLLVGVVSDILEDGRVVVKSSTGPKFVVNTSQ YINEEELKPGARVALNQQTLAIVNVLP

>2wg5-a2-m1-cL (length=87) [Search sequence]

MKQLEDKVEELLSKNYHLENEVARLRSPPLLVGVVSDILEDGRVVVKSSTGPKFVVNTSQ YINEEELKPGARVALNQQTLAIVNVLP

Structure information

PDB ID	2wg5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Proteasome-Activating Nucleotidase (PAN) N-domain (57-134) from Archaeoglobus fulgidus fused to GCN4
Assembly ID	2
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	96
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	K	L
UniProt accession	O28303	O28303
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2wg5-a2-m1-cK_2wg5-a2-m1-cL.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2wg5-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2wg5/1/1:A/1:B 2wg5/1/1:C/1:D 2wg5/1/1:E/1:F 2wg5/2/1:G/1:H 2wg5/2/1:I/1:J 2wg6/1/1:A/1:B 2wg6/1/1:C/1:D 2wg6/1/1:E/1:F 2wg6/2/1:G/1:H 2wg6/2/1:I/1:J 2wg6/2/1:K/1:L
Other dimers with similar sequences but different poses	2wg5/2/1:G/1:L 2wg5/1/1:A/1:F 2wg5/1/1:B/1:C 2wg5/1/1:D/1:E 2wg5/2/1:H/1:I 2wg5/2/1:J/1:K 2wg6/1/1:A/1:F 2wg6/1/1:B/1:C 2wg6/1/1:D/1:E 2wg6/2/1:G/1:L 2wg6/2/1:H/1:I 2wg6/2/1:J/1:K