2wkc/1/1:A/1:C

Sequences

>2wkc-a1-m1-cA (length=90) [Search sequence]

GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTV TVSGRVQAKESGEYVNYNFVFPTVEKVFIT

>2wkc-a1-m1-cC (length=90) [Search sequence]

GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTV TVSGRVQAKESGEYVNYNFVFPTVEKVFIT

Structure information

PDB ID	2wkc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure from a single-stranded DNA binding protein from the lactococcal phage p2
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	Q09WL7	Q09WL7
Species	254252 (Lactococcus virus P2)	254252 (Lactococcus virus P2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2wkc-a1-m1-cA_2wkc-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2wkc-assembly1.cif.gz