2wkc/1/1:B/1:C

Sequences
>2wkc-a1-m1-cB (length=89) [Search sequence]
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTV
TVSGRVQAKESGEYVNYNFVFPTVEKVFI
>2wkc-a1-m1-cC (length=90) [Search sequence]
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTV
TVSGRVQAKESGEYVNYNFVFPTVEKVFIT
Structure information
PDB ID 2wkc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure from a single-stranded DNA binding protein from the lactococcal phage p2
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q09WL7 Q09WL7
Species 254252 (Lactococcus virus P2) 254252 (Lactococcus virus P2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2wkc-a1-m1-cB_2wkc-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2wkc-assembly1.cif.gz

[Back to Home]