2wpo/2/1:C/1:D

Sequences

>2wpo-a2-m1-cC (length=230) [Search sequence]

DEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQLSVALPLNINHDDTAVV
GHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYA
GLSLSSRRCDDVEQTTPFKHVALCSVGRRRGTLAVYGRDPEWVMQRFPDLTAADRDGLRA
QWQSGDPFRSDSYGLLGNSVDAMYIRERLPKLRYDKQLVGVTERESYVKA

>2wpo-a2-m1-cD (length=230) [Search sequence]

Structure information

PDB ID	2wpo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	HCMV protease inhibitor complex
Assembly ID	2
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	105
Sequence identity between the two chains	1.0
PubMed citation	9731777

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P16753	P16753
Species	10359 (Human betaherpesvirus 5)	10359 (Human betaherpesvirus 5)
Function annotation	BioLiP:2wpoC	BioLiP:2wpoD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2wpo-a2-m1-cC_2wpo-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2wpo-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1id4/1/1:A/1:B 1iec/1/1:A/1:B 1ief/1/1:A/1:B 1ieg/1/1:A/1:B 1jq7/1/1:A/1:B 1njt/1/1:A/1:B 1njt/1/1:E/1:A 1nju/1/1:A/1:B 1nju/2/1:C/1:D 1nju/3/1:A/1:B 1nju/3/1:C/1:D 1nkk/1/1:A/1:B 1nkk/1/1:E/1:A 1nkk/1/1:F/1:B 1nkk/2/1:D/1:C 1nkk/2/1:G/1:C 1nkk/2/1:H/1:D 1wpo/1/1:A/1:B 2wpo/1/1:A/1:B 7tcz/1/1:A/2:A