2wq0/1/2:A/3:A

Sequences
>2wq0-a1-m2-cA (length=31) [Search sequence]
MKQLEDKIEENTSKIYHNTNEIARNTKLVGE
>2wq0-a1-m3-cA (length=31) [Search sequence]
MKQLEDKIEENTSKIYHNTNEIARNTKLVGE
Structure information
PDB ID 2wq0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
Assembly ID 1
Resolution 1.12Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession P03069 P03069
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2wq0-a1-m2-cA_2wq0-a1-m3-cA.pdb.gz
Full biological assembly
Download: 2wq0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2wq0/1/1:A/2:A 2wq0/1/1:A/3:A 2wq1/1/1:A/2:A 2wq1/1/1:A/3:A 2wq1/1/2:A/3:A 2wq2/1/1:A/2:A 2wq2/1/1:A/3:A 2wq2/1/2:A/3:A 2wq3/1/1:A/2:A 2wq3/1/1:A/3:A 2wq3/1/2:A/3:A

[Back to Home]