2wqj/5/1:2/1:Z

Sequences

>2wqj-a5-m1-c2 (length=27) [Search sequence]

DTYYLQVRGRENFEILMKLKESLELME

>2wqj-a5-m1-cZ (length=31) [Search sequence]

DTYYLQVRGRENFEILMKLKESLELMELVPQ

Structure information

PDB ID	2wqj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a truncated variant of the human p73 tetramerization domain
Assembly ID	5
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0
PubMed citation	19815500

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	2	Z
UniProt accession	O15350	O15350
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2wqjZ

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2wqj-a5-m1-c2_2wqj-a5-m1-cZ.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2wqj-assembly5.cif.gz