2wsb/1/1:A/1:D

Sequences

>2wsb-a1-m1-cA (length=254) [Search sequence]

MDYRTVFRLDGACAAVTGAGSGIGLEICRAFAASGARLILIDREAAALDRAAQELGAAVA
ARIVADVTDAEAMTAAAAEAEAVAPVSILVNSAGIARLHDALETDDATWRQVMAVNVDGM
FWASRAFGRAMVARGAGAIVNLGSMSGTIVNRPQFASSYMASKGAVHQLTRALAAEWAGR
GVRVNALAPGYVATEMTLKMRERPELFETWLDMTPMGRCGEPSEIAAAALFLASPAASYV
TGAILAVDGGYTVW

>2wsb-a1-m1-cD (length=254) [Search sequence]

Structure information

PDB ID	2wsb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the short-chain dehydrogenase Galactitol- Dehydrogenase (GatDH) of Rhodobacter sphaeroides in complex with NAD
Assembly ID	1
Resolution	1.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	151
Sequence identity between the two chains	1.0
PubMed citation	20410293

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	C0KTJ6	C0KTJ6
Species	1063 (Cereibacter sphaeroides)	1063 (Cereibacter sphaeroides)
Function annotation	BioLiP:2wsbA	BioLiP:2wsbD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2wsb-a1-m1-cA_2wsb-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2wsb-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2wdz/1/1:A/1:B 2wdz/1/2:A/2:B 2wdz/2/1:C/3:C 2wdz/2/1:D/3:D 2wsb/1/1:B/1:C 3lqf/1/1:A/1:C 3lqf/1/1:B/1:D
Other dimers with similar sequences but different poses	2wsb/1/1:C/1:D 2wdz/1/1:A/2:A 2wdz/1/1:B/2:B 2wdz/2/1:C/3:D 2wdz/2/1:D/3:C 2wsb/1/1:A/1:B 3lqf/1/1:A/1:B 3lqf/1/1:C/1:D 2wsb/1/1:B/1:D 2wdz/1/1:A/2:B 2wdz/1/1:B/2:A 2wdz/2/1:C/1:D 2wdz/2/3:C/3:D 2wsb/1/1:A/1:C 3lqf/1/1:A/1:D 3lqf/1/1:B/1:C