2wx4/2/1:E/1:D

Sequences
>2wx4-a2-m1-cE (length=43) [Search sequence]
HMADLLLNSTQFVQAFTYLIQNDKEFANKLHKAYLNGCSNLLL
>2wx4-a2-m1-cD (length=45) [Search sequence]
GPHMADLLLNSTQFVQAFTYLIQNDKEFANKLHKAYLNGCSNLLL
Structure information
PDB ID 2wx4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Asymmetric trimer of the Drosophila melanogaster DCP1 C-terminal domain
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E D
UniProt accession Q9W1H5 Q9W1H5
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2wx4-a2-m1-cE_2wx4-a2-m1-cD.pdb.gz
Full biological assembly
Download: 2wx4-assembly2.cif.gz

[Back to Home]