2wy2/1/1:B/1:C

Sequences

>2wy2-a1-m1-cB (length=103) [Search sequence]

AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIE GDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA

>2wy2-a1-m1-cC (length=103) [Search sequence]

AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIE GDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA

Structure information

PDB ID	2wy2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P69791	P69791
Species	562 (Escherichia coli)	562 (Escherichia coli)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2wy2-a1-m1-cB_2wy2-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2wy2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1wcr/1/1:A/1:B 1wcr/1/1:A/1:C 1wcr/1/1:B/1:C 2lrk/1/1:A/1:B 2lrk/1/1:A/1:C 2lrk/1/1:B/1:C 2lrl/1/1:A/1:B 2lrl/1/1:A/1:C 2lrl/1/1:B/1:C 2wwv/1/1:A/1:B 2wwv/1/1:A/1:C 2wwv/1/1:B/1:C 2wy2/1/1:A/1:B 2wy2/1/1:A/1:C