2x3g/1/1:A/2:A

Sequences
>2x3g-a1-m1-cA (length=113) [Search sequence]
GDLKKVLNFHFSYIYTYFITITTNYKYGDTEKIFRKFRSYIYNHDKNSHVFSIKETSNGL
HYHILVFTNKKLDYSRVHKHPSHSDIRIELVPKSISDIKNVYKYLKTKKDIKS
>2x3g-a1-m2-cA (length=113) [Search sequence]
GDLKKVLNFHFSYIYTYFITITTNYKYGDTEKIFRKFRSYIYNHDKNSHVFSIKETSNGL
HYHILVFTNKKLDYSRVHKHPSHSDIRIELVPKSISDIKNVYKYLKTKKDIKS
Structure information
PDB ID 2x3g (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the hypothetical protein ORF119 from Sulfolobus islandicus rod-shaped virus 1
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q5TJA9 Q5TJA9
Species 282066 (Sulfolobus islandicus rudivirus 1 variant XX) 282066 (Sulfolobus islandicus rudivirus 1 variant XX)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2x3g-a1-m1-cA_2x3g-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2x3g-assembly1.cif.gz

[Back to Home]