2x4k/1/3:A/3:B

Sequences
>2x4k-a1-m3-cA (length=62) [Search sequence]
SMMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRK
SD
>2x4k-a1-m3-cB (length=62) [Search sequence]
SMMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRK
SD
Structure information
PDB ID 2x4k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SAR1376, a putative 4-oxalocrotonate tautomerase from the methicillin-resistant Staphylococcus aureus (MRSA)
Assembly ID 1
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 102
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession Q6GH41 Q6GH41
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2x4k-a1-m3-cA_2x4k-a1-m3-cB.pdb.gz
Full biological assembly
Download: 2x4k-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2x4k/1/1:A/1:B 2x4k/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 2x4k/1/2:B/3:B 2x4k/1/1:A/2:A 2x4k/1/1:A/3:A 2x4k/1/1:B/2:B 2x4k/1/1:B/3:B 2x4k/1/2:A/3:A
  • [Back to Home]