2x57/1/2:A/2:C

Sequences
>2x57-a1-m2-cA (length=102) [Search sequence]
GVDLGTENLYFQSRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVT
VPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDP
>2x57-a1-m2-cC (length=102) [Search sequence]
GVDLGTENLYFQSRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVT
VPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDP
Structure information
PDB ID 2x57 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the extracellular domain of human Vasoactive intestinal polypeptide receptor 2
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A C
UniProt accession P41587 P41587
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2x57-a1-m2-cA_2x57-a1-m2-cC.pdb.gz
Full biological assembly
Download: 2x57-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2x57/1/1:A/1:B 2x57/1/1:A/1:C 2x57/1/1:C/1:B 2x57/1/2:A/2:B 2x57/1/2:C/2:B
Other dimers with similar sequences but different poses
  • 2x57/1/2:C/1:B 2x57/1/1:A/2:A 2x57/1/1:C/2:B
  • [Back to Home]