2x57/1/2:C/1:B

Sequences

>2x57-a1-m2-cC (length=102) [Search sequence]

GVDLGTENLYFQSRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVT VPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDP

>2x57-a1-m1-cB (length=104) [Search sequence]

SSGVDLGTENLYFQSRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDP

Structure information

PDB ID	2x57 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the extracellular domain of human Vasoactive intestinal polypeptide receptor 2
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	C	B
UniProt accession	P41587	P41587
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2x57-a1-m2-cC_2x57-a1-m1-cB.pdb.gz

Full biological assembly Download: 2x57-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2x57/1/1:A/2:A 2x57/1/1:C/2:B
Other dimers with similar sequences but different poses	2x57/1/2:A/2:C 2x57/1/1:A/1:B 2x57/1/1:A/1:C 2x57/1/1:C/1:B 2x57/1/2:A/2:B 2x57/1/2:C/2:B