2x5c/2/1:B/3:B

Sequences
>2x5c-a2-m1-cB (length=101) [Search sequence]
YKQEYDMAADLVRMLRGLGVFMHAKCPRCGAEGSVSIVETKNGYKYLVIRHPDGGTHTVP
KTDISAILKELCEVKKDLEYVLKRYKEYEEEGGVKFCAEGR
>2x5c-a2-m3-cB (length=101) [Search sequence]
YKQEYDMAADLVRMLRGLGVFMHAKCPRCGAEGSVSIVETKNGYKYLVIRHPDGGTHTVP
KTDISAILKELCEVKKDLEYVLKRYKEYEEEGGVKFCAEGR
Structure information
PDB ID 2x5c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of hypothetical protein ORF131 from Pyrobaculum Spherical Virus
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 83
Sequence identity between the two chains 1.0
PubMed citation 20419351
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession Q6ZYH1 Q6ZYH1
Species 270161 (Pyrobaculum spherical virus) 270161 (Pyrobaculum spherical virus)
Function annotation BioLiP:2x5cB BioLiP:2x5cB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2x5c-a2-m1-cB_2x5c-a2-m3-cB.pdb.gz
Full biological assembly
Download: 2x5c-assembly2.cif.gz
Similar dimers

[Back to Home]