2xa6/1/1:A/1:B

Sequences
>2xa6-a1-m1-cA (length=37) [Search sequence]
PENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKG
>2xa6-a1-m1-cB (length=37) [Search sequence]
PENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKG
Structure information
PDB ID 2xa6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis for homodimerization of the Src-associated during mitosis, 68 kD protein (Sam68) Qua1 domain
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q07666 Q07666
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2xa6-a1-m1-cA_2xa6-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2xa6-assembly1.cif.gz

[Back to Home]