2xf6/1/2:A/6:A

Sequences

>2xf6-a1-m2-cA (length=50) [Search sequence]

SESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWND

>2xf6-a1-m6-cA (length=50) [Search sequence]

SESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWND

Structure information

PDB ID	2xf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Bacillus subtilis SPP1 phage gp23.1, a putative chaperone.
Assembly ID	1
Resolution	2.12Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	6
Chain ID	A	A
UniProt accession	O48468	O48468
Species	10724 (Bacillus phage SPP1)	10724 (Bacillus phage SPP1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2xf6-a1-m2-cA_2xf6-a1-m6-cA.pdb.gz

Full biological assembly Download: 2xf6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2xf5/1/1:A/1:C 2xf5/1/1:A/1:F 2xf5/1/1:D/1:C 2xf5/1/1:D/1:E 2xf5/1/1:E/1:B 2xf5/1/1:F/1:B 2xf6/1/1:A/3:A 2xf6/1/1:A/6:A 2xf6/1/2:A/4:A 2xf6/1/3:A/5:A 2xf6/1/4:A/5:A 2xf7/1/1:A/1:C 2xf7/1/1:C/1:D 2xf7/1/1:D/1:E 2xf7/1/1:E/1:B 2xf7/1/1:F/1:B