2xfl/2/1:E/1:G

Sequences

>2xfl-a2-m1-cE (length=136) [Search sequence]

DSYVHRHVVTFDETNLVGNVYFAHYLHWQGHCREHFLADHAPGVMAALADGLALVTVDCH ADFYAEGSAFDEVEVRMMLDRLDGHRIAMSFDYVRVAPGPPTLLAQGRQTVACMRRAGHG LEPVEVPAELRRALSR

>2xfl-a2-m1-cG (length=141) [Search sequence]

DSYVHRHVVTFDETNLVGNVYFAHYLHWQGHCREHFLADHAPGVMAALADGLALVTVDCH ADFYAEGSAFDEVEVRMMLDRLDGHRIAMSFDYVRVAPGPPTLLAQGRQTVACMRRAGHG LEPVEVPAELRRALSRYAVVA

Structure information

PDB ID	2xfl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Induced-fit and allosteric effects upon polyene binding revealed by crystal structures of the Dynemicin thioesterase
Assembly ID	2
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	Q84HI7	Q84HI7
Species	47854 (Micromonospora chersina)	47854 (Micromonospora chersina)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2xfl-a2-m1-cE_2xfl-a2-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2xfl-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2xem/1/1:B/1:A 2xem/1/1:C/1:D 2xfl/1/1:A/1:B 2xfl/1/1:C/1:D 2xfl/2/1:F/1:H
Other dimers with similar sequences but different poses	2xfl/2/1:F/1:G 2xem/1/1:A/1:D 2xem/1/1:B/1:C 2xfl/1/1:A/1:D 2xfl/1/1:C/1:B 2xfl/2/1:E/1:H 2xfl/2/1:G/1:H 2xem/1/1:B/1:D 2xem/1/1:C/1:A 2xfl/1/1:B/1:D 2xfl/1/1:C/1:A 2xfl/2/1:E/1:F