2xg8/1/2:D/2:E

Sequences
>2xg8-a1-m2-cD (length=87) [Search sequence]
SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVD
NRLRQLRRDASLQEYNQLQQVFKQTFL
>2xg8-a1-m2-cE (length=87) [Search sequence]
SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVD
NRLRQLRRDASLQEYNQLQQVFKQTFL
Structure information
PDB ID 2xg8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis of gene regulation by protein PII: The crystal complex of PII and PipX from Synechococcus elongatus PCC 7942
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID D E
UniProt accession Q7X386 Q7X386
Species 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) 1140 (Synechococcus elongatus PCC 7942 = FACHB-805)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2xg8-a1-m2-cD_2xg8-a1-m2-cE.pdb.gz
Full biological assembly
Download: 2xg8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2xg8/1/1:D/1:E 2xg8/1/1:F/1:D 2xg8/1/1:F/1:E 2xg8/1/2:F/2:D 2xg8/1/2:F/2:E

[Back to Home]