2xgf/1/1:B/1:C

Sequences

>2xgf-a1-m1-cB (length=216) [Search sequence]

SSYPIGAPIPWPSDSVPAGFALMEGQTFDKSAYPKLAVAYPSGVIPDMRGQTIKGKPSGR
AVLSAEADGVKAHSHSASASSTDLGTKTTSSFDYGTKGTNSTGGHTHSGSGSTSTNGEHS
HYIEAWNGTGVGGNKMSSYAISYRAGGSNTNAAGNHSHTFSFGTSSAGDHSHSVGIGAHT
HTVAIGSHGHTITVNSTGNTENTVKNIAFNYIVRLA

>2xgf-a1-m1-cC (length=216) [Search sequence]

Structure information

PDB ID	2xgf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the bacteriophage T4 long tail fibre needle-shaped receptor-binding tip
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	507
Sequence identity between the two chains	1.0
PubMed citation	21041684

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P03744	P03744
Species	10665 (Tequatrovirus T4)	10665 (Tequatrovirus T4)
Function annotation	BioLiP:2xgfB	BioLiP:2xgfC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2xgf-a1-m1-cB_2xgf-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2xgf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2xgf/1/1:A/1:B 2xgf/1/1:A/1:C