2xj3/1/1:B/1:A

Sequences

>2xj3-a1-m1-cB (length=65) [Search sequence]

MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNCPLEDI FQWQP

>2xj3-a1-m1-cA (length=66) [Search sequence]

MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNCPLEDI FQWQPE

Structure information

PDB ID	2xj3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	High resolution structure of the T55C mutant of CylR2.
Assembly ID	1
Resolution	1.23Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q8VL32	Q8VL32
Species	1351 (Enterococcus faecalis)	1351 (Enterococcus faecalis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2xj3-a1-m1-cB_2xj3-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2xj3-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1utx/1/1:A/1:B 2gzu/1/1:A/1:B 2lyj/1/1:A/1:B 2lyk/1/1:A/1:B 2xi8/1/1:A/1:B 2xiu/1/1:B/1:A