2xmv/1/1:E/1:F

Sequences
>2xmv-a1-m1-cE (length=63) [Search sequence]
TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGY
EVE
>2xmv-a1-m1-cF (length=63) [Search sequence]
TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGY
EVE
Structure information
PDB ID 2xmv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Copper chaperone Atx1 from Synechocystis PCC6803 (Cu1, trimeric form, His61Tyr mutant)
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
PubMed citation 20726513
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession P73213 P73213
Species 1148 (Synechocystis sp. PCC 6803) 1148 (Synechocystis sp. PCC 6803)
Function annotation BioLiP:2xmvE BioLiP:2xmvF
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2xmv-a1-m1-cE_2xmv-a1-m1-cF.pdb.gz
Full biological assembly
Download: 2xmv-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2xmv/1/1:A/1:B 2xmv/1/1:A/1:C 2xmv/1/1:B/1:C 2xmv/1/1:D/1:E 2xmv/1/1:D/1:F
Other dimers with similar sequences but different poses
  • 4a47/2/1:B/3:B 2xmj/1/1:B/1:A 2xmk/1/1:A/1:B 2xmm/1/1:A/1:B 4a46/1/1:A/1:B 4a46/1/1:C/1:D 4a47/1/1:A/2:A 4a47/3/1:C/2:C 4a47/4/1:D/3:D
  • 2xmt/1/1:A/1:B 2xmu/1/1:A/1:B
  • 2xmv/1/1:A/1:F 2xmv/1/1:B/1:E 2xmv/1/1:C/1:D
  • [Back to Home]