2xtd/1/2:B/2:A

Sequences
>2xtd-a1-m2-cB (length=64) [Search sequence]
SITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVE
AEIS
>2xtd-a1-m2-cA (length=68) [Search sequence]
MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYV
EAEISINE
Structure information
PDB ID 2xtd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the TBL1 tetramerisation domain
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 88
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession O60907 O60907
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2xtd-a1-m2-cB_2xtd-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2xtd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2xtc/1/1:B/1:A 2xtc/1/2:B/2:A 2xtd/1/1:B/1:A 2xte/1/1:A/1:B 2xte/1/1:I/1:J 2xte/2/1:C/1:D 2xte/2/1:K/1:L 2xte/3/1:E/1:F 2xte/3/1:G/1:H

[Back to Home]