2xvt/2/1:B/1:C

Sequences
>2xvt-a2-m1-cB (length=78) [Search sequence]
VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAE
RIIFETHQIHFANCSLVQ
>2xvt-a2-m1-cC (length=79) [Search sequence]
VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAE
RIIFETHQIHFANCSLVQP
Structure information
PDB ID 2xvt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the extracellular domain of human RAMP2
Assembly ID 2
Resolution 2.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O60895 O60895
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2xvtC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2xvt-a2-m1-cB_2xvt-a2-m1-cC.pdb.gz
Full biological assembly
Download: 2xvt-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2xvt/1/1:D/1:F 2xvt/1/1:E/1:D 2xvt/1/1:E/1:F 2xvt/2/1:A/1:B 2xvt/2/1:A/1:C 3aqe/7/1:A/1:B 3aqe/7/1:C/1:A 3aqe/7/1:C/1:B 3aqe/8/1:D/1:E 3aqe/8/1:D/1:F 3aqe/8/1:F/1:E

[Back to Home]