2xzz/1/10:A/9:A

Sequences
>2xzz-a1-m10-cA (length=97) [Search sequence]
SMLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV
TLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVA
>2xzz-a1-m9-cA (length=97) [Search sequence]
SMLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV
TLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVA
Structure information
PDB ID 2xzz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the human transglutaminase 1 beta-barrel domain
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 10 9
Chain ID A A
UniProt accession P22735 P22735
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2xzz-a1-m10-cA_2xzz-a1-m9-cA.pdb.gz
Full biological assembly
Download: 2xzz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2xzz/1/11:A/18:A 2xzz/1/12:A/13:A 2xzz/1/15:A/8:A 2xzz/1/16:A/20:A 2xzz/1/17:A/21:A 2xzz/1/19:A/22:A 2xzz/1/1:A/14:A 2xzz/1/23:A/5:A 2xzz/1/24:A/4:A 2xzz/1/2:A/3:A 2xzz/1/6:A/7:A
Other dimers with similar sequences but different poses
  • 2xzz/1/24:A/9:A 2xzz/1/10:A/14:A 2xzz/1/10:A/15:A 2xzz/1/11:A/22:A 2xzz/1/11:A/4:A 2xzz/1/12:A/19:A 2xzz/1/12:A/2:A 2xzz/1/13:A/14:A 2xzz/1/13:A/15:A 2xzz/1/16:A/5:A 2xzz/1/16:A/7:A 2xzz/1/17:A/23:A 2xzz/1/17:A/9:A 2xzz/1/18:A/5:A 2xzz/1/18:A/7:A 2xzz/1/19:A/6:A 2xzz/1/1:A/22:A 2xzz/1/1:A/4:A 2xzz/1/20:A/21:A 2xzz/1/20:A/3:A 2xzz/1/21:A/8:A 2xzz/1/23:A/24:A 2xzz/1/2:A/6:A 2xzz/1/3:A/8:A
  • 2xzz/1/4:A/9:A 2xzz/1/10:A/17:A 2xzz/1/10:A/8:A 2xzz/1/11:A/24:A 2xzz/1/11:A/5:A 2xzz/1/12:A/15:A 2xzz/1/12:A/3:A 2xzz/1/13:A/19:A 2xzz/1/14:A/4:A 2xzz/1/14:A/9:A 2xzz/1/15:A/3:A 2xzz/1/16:A/21:A 2xzz/1/16:A/23:A 2xzz/1/17:A/8:A 2xzz/1/18:A/22:A 2xzz/1/18:A/6:A 2xzz/1/1:A/13:A 2xzz/1/1:A/19:A 2xzz/1/20:A/7:A 2xzz/1/21:A/23:A 2xzz/1/22:A/6:A 2xzz/1/24:A/5:A 2xzz/1/2:A/20:A 2xzz/1/2:A/7:A
  • [Back to Home]