2y4y/1/1:B/2:D

Sequences
>2y4y-a1-m1-cB (length=76) [Search sequence]
RVKQFLEGFNIETFEMVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISEGKI
DVIEIVLERPRSLTLK
>2y4y-a1-m2-cD (length=80) [Search sequence]
KPDRVKQFLEGFNIETFEMVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISE
GKIDVIEIVPWLERPRSLTL
Structure information
PDB ID 2y4y (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a domain from the type IV pilus biogenesis lipoprotein PilP, from Pseudomonas aeruginosa
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 0.987
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B D
UniProt accession G3XCX7 G3XCX7
Species 208964 (Pseudomonas aeruginosa PAO1) 208964 (Pseudomonas aeruginosa PAO1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2y4y-a1-m1-cB_2y4y-a1-m2-cD.pdb.gz
Full biological assembly
Download: 2y4y-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2y4y/1/2:B/2:C 2y4y/1/1:B/1:C
  • [Back to Home]