2y75/5/1:C/1:D

Sequences
>2y75-a5-m1-cC (length=127) [Search sequence]
MLKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIR
GGGYVLGSEPDAITAGDIIRVLEGPISPVEVLEDEEPAKRELWIRIRDAVKEVLDSTTLE
DLASYTD
>2y75-a5-m1-cD (length=128) [Search sequence]
MLKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIR
GAYGGYVLGSEPDAITAGDIIRVLEGPISPVEVLEDEEPAKRELWIRIRDAVKEVLDSTT
LEDLASYT
Structure information
PDB ID 2y75 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of CymR (YrzC) the Global Cysteine Regulator of B. subtilis
Assembly ID 5
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 108
Sequence identity between the two chains 0.992
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession O34527 O34527
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2y75-a5-m1-cC_2y75-a5-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2y75-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2y75/1/1:A/1:B 2y75/1/1:C/1:D 2y75/1/1:E/1:F 2y75/4/1:A/1:B 2y75/6/1:E/1:F
Other dimers with similar sequences but different poses
  • 2y75/2/1:D/1:F 2y75/1/1:A/1:C 2y75/1/1:A/1:E 2y75/1/1:B/1:D 2y75/1/1:B/1:F 2y75/1/1:C/1:E 2y75/1/1:D/1:F 2y75/2/1:B/1:D 2y75/2/1:B/1:F 2y75/3/1:A/1:C 2y75/3/1:A/1:E 2y75/3/1:C/1:E
  • 2y75/1/1:C/1:F 2y75/1/1:A/1:D 2y75/1/1:B/1:E
    		•

    [Back to Home]